3.98 Rating by CuteStat

rajamusicbank.com is 1 decade 3 years old. It is a domain having com extension. It has a global traffic rank of #622720 in the world. This website is estimated worth of $ 1,920.00 and have a daily income of around $ 8.00. As no active threats were reported recently by users, rajamusicbank.com is SAFE to browse.

PageSpeed Score
59
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 1,352
Daily Pageviews: 2,704

Estimated Valuation

Income Per Day: $ 8.00
Estimated Worth: $ 1,920.00

Search Engine Indexes

Google Indexed Pages: 15,600
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 551
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 622,720
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.24.200.143

Hosted Country:

India IN

Location Latitude:

21.9974

Location Longitude:

79.0011
.: Musicologist Raja | Exclusive Telugu Lyrics Website | Telugu Film Songs Reviews :.

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 15
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.24.200.143)

web designing company Hyderabad, web designing in Hyderabad ,web desig

- outlinedesigns.in

web Design Company Hyderabad , Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad ,Vijayawada, web design services Hyderabad, website design services Hyderabad

Not Applicable $ 8.95

.:: Immigration Assistance|Infrastructure|Project Management|Applicati

- eforcesol.com

Immigration Assistance,Infrastructure,Project Management,Application Development,ERP,CRM,Engineering Services,QA Testing,eForce Solutions

Not Applicable $ 8.95

.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Medinova, Kolkata: serology, endocrinology, ultrasound investigations

- medinovaindia.com

Medinova Diagnostics: aematology, micro-biology, histopathology, serology, endocrinology, ultrasound investigations imaging systems, colour dopplers, ECG Machines, cardiac stress system, blood test, CT scan, MRI Scan. lab, radiology, imageology, cardiology gastroscopy, aematology, micro-biology, histopathology, serolog

5,159,456 $ 240.00

Index of /

- sumashaila.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 12 Dec 2019 09:16:19 GMT
Server: Apache
X-Powered-By: PHP/5.6.40
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: Nimzo 27, LLC
Registration Date: Nov 28, 2010, 11:33 AM 1 decade 3 years 4 months ago
Expiration Date: Nov 28, 2020, 11:33 AM 3 years 4 months 4 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns1.lazybulls.com 103.24.200.143 India India
ns2.lazybulls.com 103.24.202.176 India India

DNS Record Analysis

Host Type TTL Extra
rajamusicbank.com A 10798 IP: 103.24.200.143
rajamusicbank.com NS 86400 Target: ns2.lazybulls.com
rajamusicbank.com NS 86400 Target: ns1.lazybulls.com
rajamusicbank.com SOA 10800 MNAME: ns1.lazybulls.com
RNAME: root.i-h1-cs-r04-i0117-141.webazilla.com
Serial: 2019061801
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
rajamusicbank.com MX 14400 Target: rajamusicbank.com
rajamusicbank.com TXT 14400 TXT: v=spf1 ip4:103.24.200.143
ip4:103.24.200.141 ip4:142.44.174.193
ip4:103.24.202.75 +ip4:192.163.253.54
+ip4:162.144.54.172 +ip4:162.144.64.55
+a +mx +ip4:162.144.112.204 ~all

Similarly Ranked Websites

Wii Downloadables - Wii Dvd - Wii Software - Wii Unlock - 4.3

- wiidownloadables.com
622,721 $ 1,200.00

401 Unauthorized

- firmen-informer.de
622,722 $ 1,920.00

Express Store | Jidd Motors

- express.jiddmotors.com

Buy or lease your next car online at Jidd Motors. Get instant pricing & save hours at the dealership. Includes home delivery.

622,722 $ 1,920.00

– Тула активная

- tulactive.ru
622,723 $ 1,920.00

Gradus.Pro :: Портал гражданской журналистики

- gradus.pro

Новости Северной Осетии, статьи о политике, экономике, спорте, культуре, обществе РСО-Алания, афиша мероприятий Владикавказа, блоги Владикавказа, Осетии

622,725 $ 1,920.00

Full WHOIS Lookup

Domain Name: RAJAMUSICBANK.COM
Registry Domain ID: 1627650229_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2019-11-13T10:33:24Z
Creation Date: 2010-11-28T05:48:15Z
Registrar Registration Expiration Date: 2020-11-28T05:48:15Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Outline Designs
Registrant Organization: Outline Designs
Registrant Street: Flat No: 608, taj enclave Lakdikapool
Registrant City: Hyderabad
Registrant State/Province: Andhra Pradesh
Registrant Postal Code: 500004
Registrant Country: IN
Registrant Phone: +91.04064538777
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: info@outlinedesigns.in
Registry Admin ID: Not Available From Registry
Admin Name: Outline Designs
Admin Organization: Outline Designs
Admin Street: Flat No: 608, taj enclave Lakdikapool
Admin City: Hyderabad
Admin State/Province: Andhra Pradesh
Admin Postal Code: 500004
Admin Country: IN
Admin Phone: +91.04064538777
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: info@outlinedesigns.in
Registry Tech ID: Not Available From Registry
Tech Name: Outline Designs
Tech Organization: Outline Designs
Tech Street: Flat No: 608, taj enclave Lakdikapool
Tech City: Hyderabad
Tech State/Province: Andhra Pradesh
Tech Postal Code: 500004
Tech Country: IN
Tech Phone: +91.04064538777
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: info@outlinedesigns.in
Name Server: ns1.lazybulls.com
Name Server: ns2.lazybulls.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-12T09:16:35Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: OUTLINE DOMAINS

The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is PDR Ltd. d/b/a PublicDomainRegistry.com.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.